PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009591172.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 358aa    MW: 40625.1 Da    PI: 8.4688
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009591172.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.46.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l   ++++G g+W++ +++ g++R++k+c++rw +yl
   XP_009591172.1 14 KGPWTPEEDQKLMAFIEKYGCGSWRALPAKAGLKRCGKSCRLRWINYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.52.7e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E++ +++++++lG++ W++Ia++++ +Rt++++k++w+++l
   XP_009591172.1  67 RGKFSLQEEQTIIQLHALLGNR-WSAIAAHLP-NRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.874961IPR017930Myb domain
SuperFamilySSF466895.5E-3111108IPR009057Homeodomain-like
SMARTSM007177.5E-131363IPR001005SANT/Myb domain
PfamPF002495.9E-161461IPR001005SANT/Myb domain
CDDcd001672.67E-101661No hitNo description
PROSITE profilePS5129426.32262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.0E-2765116IPR009057Homeodomain-like
SMARTSM007172.9E-1766114IPR001005SANT/Myb domain
PfamPF002491.1E-1667112IPR001005SANT/Myb domain
CDDcd001671.27E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MGRSPCCEKV GLKKGPWTPE EDQKLMAFIE KYGCGSWRAL PAKAGLKRCG KSCRLRWINY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNRWS AIAAHLPNRT DNEIKNYWNT HLKKRLTKMG  120
IDPTTHKPKT NIFGKDAANL SHMAQWENAR LEAEARLVRE SKKQISNQFG PNLATKPISY  180
GNQRNILPLQ TKIPPCLDVL KAWQGTNWTT KPKTKDMTSS VFYPFFDSPT STSNLSNNNL  240
FMVPNNNIPG LVDMNSCLVA ASNFVENTKE EVQTEWKCYE KSNNELLSQI NDISYSNDSS  300
TYNMSITDQS SLCVIQGFTH LENIVGSCED NIFEDDNNNN YWNTILNSCT LPADSPVF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009591172.10.0PREDICTED: transcription factor MYB39-like
RefseqXP_016468968.10.0PREDICTED: transcription factor MYB39-like
TrEMBLM1C9301e-142M1C930_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000624371e-142(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.13e-99myb domain protein 16